Tropomyosin anticorps
-
- Antigène Voir toutes Tropomyosin (TPM1) Anticorps
- Tropomyosin (TPM1) (Tropomyosin 1 (Alpha) (TPM1))
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Tropomyosin est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- Tropomyosin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKEAETRAEFAERSVTKLEKSIDDLEDQLYQQLEQNRRLTNELKLALNED
- Top Product
- Discover our top product TPM1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Tropomyosin 1 Blocking Peptide, catalog no. 33R-5082, is also available for use as a blocking control in assays to test for specificity of this Tropomyosin 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPM1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Tropomyosin (TPM1) (Tropomyosin 1 (Alpha) (TPM1))
- Autre désignation
- Tropomyosin 1 (TPM1 Produits)
- Synonymes
- anticorps alpha-fTM, anticorps Tm7, anticorps tpm1, anticorps MGC84844, anticorps AA986836, anticorps AI854628, anticorps TM2, anticorps Tm3, anticorps Tmpa, anticorps Tpm-1, anticorps alpha-TM, anticorps Alpha-tm, anticorps Tma2, anticorps Tmsa, anticorps TPM1, anticorps fb37a09, anticorps tm, anticorps wu:fb37a09, anticorps CH1, anticorps alpha-tm, anticorps alpha-tropomyosin, anticorps C15orf13, anticorps CMD1Y, anticorps CMH3, anticorps HTM-alpha, anticorps TMSA, anticorps TPMA, anticorps Tm1, anticorps zgc:171719, anticorps zgc:55951, anticorps zgc:77009, anticorps tropomyosin 1 (alpha), anticorps tropomyosin, anticorps tropomyosin 1, anticorps tropomyosin 1, alpha, anticorps alpha-tropomyosin, anticorps tropomyosin 1 L homeolog, anticorps TPM1, anticorps tm7, anticorps Tpm1, anticorps tpma, anticorps tpm1.L, anticorps Smp_044010.2, anticorps LOC732984, anticorps tpm1
- Sujet
- TPM1 is a member of the tropomyosin family of highly conserved, widely distributed actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosin is composed of two alpha-helical chains arranged as a coiled-coil. It is polymerized end to end along the two grooves of actin filaments and provides stability to the filaments. The protein is one type of alpha helical chain that forms the predominant tropomyosin of striated muscle, where it also functions in association with the troponin complex to regulate the calcium-dependent interaction of actin and myosin during muscle contraction.
- Poids moléculaire
- 28 kDa (MW of target protein)
- Pathways
- Regulation of Actin Filament Polymerization
-