BMP2K anticorps (Middle Region)
-
- Antigène Voir toutes BMP2K Anticorps
- BMP2K (BMP2 Inducible Kinase (BMP2K))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp BMP2K est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- BMP2 K antibody was raised against the middle region of BMP2
- Purification
- Affinity purified
- Immunogène
- BMP2 K antibody was raised using the middle region of BMP2 corresponding to a region with amino acids VKVLAPGEFGNHRPKGALRPGNGPEILLGQGPPQQPPQQHRVLQQLQQGD
- Top Product
- Discover our top product BMP2K Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
BMP2K Blocking Peptide, catalog no. 33R-9640, is also available for use as a blocking control in assays to test for specificity of this BMP2K antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BMP0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- BMP2K (BMP2 Inducible Kinase (BMP2K))
- Autre désignation
- BMP2K (BMP2K Produits)
- Synonymes
- anticorps zgc:101641, anticorps BIKE, anticorps 4933417M22Rik, anticorps AA673486, anticorps AV128808, anticorps BMP2 inducible kinase, anticorps BMP-2 inducible kinase, anticorps BMP2K, anticorps bmp2k, anticorps Bmp2k
- Sujet
- BMP2K is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. BMP2K is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation.
- Poids moléculaire
- 74 kDa (MW of target protein)
-