H2AFX anticorps (N-Term)

N° du produit ABIN630601

Détail du produit anti-H2AFX anticorps

Antigène: H2AFX (H2A Histone Family, Member X (H2AFX))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp H2AFX est non-conjugé

Application: Western Blotting (WB)

Specificité: H2 AFX antibody was raised against the N terminal of H2 FX

Purification: Affinity purified

Immunogène: H2 AFX antibody was raised using the N terminal of H2 FX corresponding to a region with amino acids SGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

H2AFX Blocking Peptide, catalog no. 33R-8485, is also available for use as a blocking control in assays to test for specificity of this H2AFX antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of H0 FX antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur H2AFX

Antigène: H2AFX (H2A Histone Family, Member X (H2AFX))

Autre désignation: H2AFX (H2AFX Produits)

Synonymes: anticorps H2A.X, anticorps H2A/X, anticorps H2AX, anticorps AW228881, anticorps H2ax, anticorps Hist5-2ax, anticorps gammaH2ax, anticorps zgc:56329, anticorps h2a.x, anticorps h2a/x, anticorps h2ax, anticorps RGD1566119, anticorps h2a, anticorps h2afx, anticorps H2A histone family member X, anticorps H2A histone family, member X, anticorps H2A histone family member X L homeolog, anticorps histone cluster 1, H2ah, anticorps histone cluster 2, H2ab S homeolog, anticorps histone H2AX, anticorps H2AFX, anticorps H2afx, anticorps h2afx, anticorps h2afx.L, anticorps HIST1H2AH, anticorps hist2h2ab.S, anticorps LOC100522201, anticorps LOC100720536

Sujet: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. H2AFX is a member of the histone H2A family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif.

Poids moléculaire: 16 kDa (MW of target protein)

Pathways: Telomere Maintenance, Réparation de l'ADN, Positive Regulation of Response to DNA Damage Stimulus