NASP anticorps

N° du produit ABIN630609

Détail du produit anti-NASP anticorps

Antigène: NASP (Nuclear Autoantigenic Sperm Protein (Histone-Binding) (NASP))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NASP est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: NASP antibody was raised using a synthetic peptide corresponding to a region with amino acids KEAEGSSAEYKKEIEELKELLPEIREKIEDAKESQRSGNVAELALKATLV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NASP Blocking Peptide, catalog no. 33R-4313, is also available for use as a blocking control in assays to test for specificity of this NASP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NASP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NASP

Antigène: NASP (Nuclear Autoantigenic Sperm Protein (Histone-Binding) (NASP))

Autre désignation: NASP (NASP Produits)

Synonymes: anticorps FLB7527, anticorps PRO1999, anticorps 5033430J04Rik, anticorps AI131596, anticorps AI317140, anticorps D4Ertd767e, anticorps Epcs32, anticorps Nasp-T, anticorps wu:fd20g12, anticorps zgc:56007, anticorps zgc:85651, anticorps nuclear autoantigenic sperm protein, anticorps nuclear autoantigenic sperm protein (histone-binding), anticorps NASP, anticorps Nasp, anticorps nasp

Sujet: This gene encodes a H1 histone binding protein that is involved in transporting histones into the nucleus of dividing cells. Multiple isoforms are encoded by transcript variants of this gene.

Poids moléculaire: 49 kDa (MW of target protein)