POLR1D anticorps

N° du produit ABIN630612

Détail du produit anti-POLR1D anticorps

Antigène: POLR1D (Polymerase (RNA) I Polypeptide D, 16kDa (POLR1D))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp POLR1D est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: POLR1 D antibody was raised using a synthetic peptide corresponding to a region with amino acids TRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

POLR1D Blocking Peptide, catalog no. 33R-9258, is also available for use as a blocking control in assays to test for specificity of this POLR1D antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur POLR1D

Antigène: POLR1D (Polymerase (RNA) I Polypeptide D, 16kDa (POLR1D))

Autre désignation: POLR1D (POLR1D Produits)

Synonymes: anticorps AC19, anticorps POLR1C, anticorps RPA16, anticorps RPA9, anticorps RPAC2, anticorps RPC16, anticorps RPO1-3, anticorps TCS2, anticorps 1110003G10Rik, anticorps Rpo1-3, anticorps im:7162148, anticorps zgc:136449, anticorps polr1d, anticorps rpa16, anticorps rpa9, anticorps rpac2, anticorps rpo1-3, anticorps RNA polymerase I subunit D, anticorps polymerase (RNA) I polypeptide D, anticorps polymerase (RNA) I polypeptide D, 16kDa, gene 2 L homeolog, anticorps POLR1D, anticorps Polr1d, anticorps polr1d, anticorps polr1d.2.L

Sujet: POLR1D belongs to the archaeal rpoL/eukaryotic RPB11/RPC19 RNA polymerase subunit family. DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR1D is the common core component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs.

Poids moléculaire: 15 kDa (MW of target protein)