DPPA5 anticorps (N-Term)

N° du produit ABIN630614

Détail du produit anti-DPPA5 anticorps

Antigène: DPPA5 (Developmental Pluripotency Associated 5 (DPPA5))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DPPA5 est non-conjugé

Application: Western Blotting (WB)

Specificité: DPPA5 antibody was raised against the N terminal of DPPA5

Purification: Affinity purified

Immunogène: DPPA5 antibody was raised using the N terminal of DPPA5 corresponding to a region with amino acids MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DPPA5 Blocking Peptide, catalog no. 33R-6080, is also available for use as a blocking control in assays to test for specificity of this DPPA5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPPA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DPPA5

Antigène: DPPA5 (Developmental Pluripotency Associated 5 (DPPA5))

Autre désignation: DPPA5 (DPPA5 Produits)

Synonymes: anticorps ESG1, anticorps developmental pluripotency associated 5, anticorps DPPA5, anticorps Dppa5

Sujet: DPPA5 is involved in the maintenance of embryonic stem (ES) cell pluripotency. DPPA5 is dispensable for self-renewal of pluripotent ES cells and establishment of germ cells. DPPA5 is associates with specific target mRNAs.

Poids moléculaire: 13 kDa (MW of target protein)