Cnpase anticorps (Middle Region)

N° du produit ABIN630617

L’anticorps anti-Cnpase Polyclonal Lapin est utilisé pour la détection de Cnpase dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour Cnpase anticorps (Middle Region) (ABIN630617)

Antigène: Cnpase (CNP) (2',3'-Cyclic Nucleotide 3' phosphodiesterase (CNP))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Cnpase est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Cnpase anticorps

Épitope: Middle Region

Specificité: CNP antibody was raised against the middle region of CNP

Purification: Affinity purified

Immunogène: CNP antibody was raised using the middle region of CNP corresponding to a region with amino acids LYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTII

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CNP Blocking Peptide, (ABIN5612942), is also available for use as a blocking control in assays to test for specificity of this CNP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Cnpase

Antigène: Cnpase (CNP) (2',3'-Cyclic Nucleotide 3' phosphodiesterase (CNP))

Autre désignation: CNP

Sujet: CNP belongs to the cyclic nucleotide phosphodiesterase family. It interacts with tubulin and promotes microtubule assembly for process outgrowth in oligodendrocytes. reduced CNP expression in the schizophrenic brain is relevant to disease etiology and therefore provide support for the general hypothesis that altered oligodendrocyte function is an etiological factor in schizophrenia.

Poids moléculaire: 47 kDa (MW of target protein)