Cnpase anticorps (Middle Region)

N° du produit ABIN630617

Détail du produit anti-Cnpase anticorps

Antigène: Cnpase (CNP) (2',3'-Cyclic Nucleotide 3' phosphodiesterase (CNP))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Cnpase est non-conjugé

Application: Western Blotting (WB)

Specificité: CNP antibody was raised against the middle region of CNP

Purification: Affinity purified

Immunogène: CNP antibody was raised using the middle region of CNP corresponding to a region with amino acids LYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTII

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CNP Blocking Peptide, catalog no. 33R-5574, is also available for use as a blocking control in assays to test for specificity of this CNP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Cnpase

Antigène: Cnpase (CNP) (2',3'-Cyclic Nucleotide 3' phosphodiesterase (CNP))

Autre désignation: CNP (CNP Produits)

Synonymes: anticorps CNP1, anticorps CNPase, anticorps Cnp-1, anticorps Cnp1, anticorps CNPF, anticorps CNPI, anticorps CNPII, anticorps CNP, anticorps DKFZp469F1421, anticorps cnpl, anticorps fd21d08, anticorps fi37a10, anticorps rich, anticorps sb:cb662, anticorps si:ch73-158e11.4, anticorps wu:fd21d08, anticorps wu:fd44a05, anticorps wu:fi35d08, anticorps wu:fi37a10, anticorps cnp, anticorps 2',3'-cyclic nucleotide 3' phosphodiesterase, anticorps CNP, anticorps Cnp, anticorps cnp, anticorps cnp.L

Sujet: CNP belongs to the cyclic nucleotide phosphodiesterase family. It interacts with tubulin and promotes microtubule assembly for process outgrowth in oligodendrocytes. reduced CNP expression in the schizophrenic brain is relevant to disease etiology and therefore provide support for the general hypothesis that altered oligodendrocyte function is an etiological factor in schizophrenia.

Poids moléculaire: 47 kDa (MW of target protein)