PNMA1 anticorps (Middle Region)

N° du produit ABIN630630

Détail du produit anti-PNMA1 anticorps

Antigène: PNMA1 (Paraneoplastic Antigen MA1 (PNMA1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PNMA1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PNMA1 antibody was raised against the middle region of PNMA1

Purification: Affinity purified

Immunogène: PNMA1 antibody was raised using the middle region of PNMA1 corresponding to a region with amino acids KSNNPAITTAECLKALEQVFGSVESSRDAQIKFLNTYQNPGEKLSAYVIR

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PNMA1 Blocking Peptide, catalog no. 33R-4658, is also available for use as a blocking control in assays to test for specificity of this PNMA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNMA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PNMA1

Antigène: PNMA1 (Paraneoplastic Antigen MA1 (PNMA1))

Autre désignation: PNMA1 (PNMA1 Produits)

Synonymes: anticorps PNMA1, anticorps 5730402C15Rik, anticorps MA1, anticorps PNMA family member 1, anticorps paraneoplastic antigen MA1, anticorps paraneoplastic Ma antigen 1, anticorps PNMA1, anticorps Pnma1

Sujet: PNMA1 encodes a protein that is highly restricted to the brain and testis. Anti-PNMA1 reacts mainly with subnuclear elements (including the nucleoli) and to a lesser degree the cytoplasm.

Poids moléculaire: 40 kDa (MW of target protein)