PRMT2 anticorps (N-Term)
-
- Antigène Voir toutes PRMT2 Anticorps
- PRMT2 (Protein Arginine Methyltransferase 2 (PRMT2))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PRMT2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PRMT2 antibody was raised against the N terminal of PRMT2
- Purification
- Affinity purified
- Immunogène
- PRMT2 antibody was raised using the N terminal of PRMT2 corresponding to a region with amino acids ERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQP
- Top Product
- Discover our top product PRMT2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PRMT2 Blocking Peptide, catalog no. 33R-2686, is also available for use as a blocking control in assays to test for specificity of this PRMT2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRMT2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PRMT2 (Protein Arginine Methyltransferase 2 (PRMT2))
- Autre désignation
- PRMT2 (PRMT2 Produits)
- Synonymes
- anticorps PRMT2, anticorps DKFZp459N1919, anticorps HRMT1L1, anticorps Hrmt1l1, anticorps AI504737, anticorps protein arginine methyltransferase 2, anticorps protein arginine methyltransferase 2 L homeolog, anticorps protein arginine N-methyltransferase 2, anticorps PRMT2, anticorps Prmt2, anticorps prmt2.L
- Sujet
- The protein arginine methyltransferases (PRMTs) include a family of proteins with related putative methyltransferase domains that modify chromatin and regulate cellular transcription. PRMT2 inhibits NF-kappaB-dependent transcription and promotes apoptosis and it exerts this effect by blocking nuclear export of IkappaB-alpha through a leptomycin-sensitive pathway, increasing nuclear IkappaB-alpha and decreasing NF-kappaB DNA binding. PRMT2 also rendered cells susceptible to apoptosis by cytokines or cytotoxic drugs, likely due to its effects on NF-kappaB.
- Poids moléculaire
- 49 kDa (MW of target protein)
- Pathways
- Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Nuclear Hormone Receptor Binding
-