FRS3 anticorps (Middle Region)

N° du produit ABIN630650

Détail du produit anti-FRS3 anticorps

Antigène: FRS3 (Fibroblast Growth Factor Receptor Substrate 3 (FRS3))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FRS3 est non-conjugé

Application: Western Blotting (WB)

Specificité: FRS3 antibody was raised against the middle region of FRS3

Purification: Affinity purified

Immunogène: FRS3 antibody was raised using the middle region of FRS3 corresponding to a region with amino acids GFPDGEEDETPLQKPTSTRAAIRSHGSFPVPLTRRRGSPRVFNFDFRRPG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FRS3 Blocking Peptide, catalog no. 33R-3263, is also available for use as a blocking control in assays to test for specificity of this FRS3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FRS3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FRS3

Antigène: FRS3 (Fibroblast Growth Factor Receptor Substrate 3 (FRS3))

Autre désignation: FRS3 (FRS3 Produits)

Synonymes: anticorps MGC82242, anticorps snt2, anticorps frs2b, anticorps snt-2, anticorps frs2beta, anticorps FRS2-beta, anticorps FRS2B, anticorps FRS2beta, anticorps SNT-2, anticorps SNT2, anticorps 4930417B13Rik, anticorps AI449674, anticorps Frs2beta, anticorps Snt2, anticorps fibroblast growth factor receptor substrate 3 S homeolog, anticorps fibroblast growth factor receptor substrate 3, anticorps frs3.S, anticorps FRS3, anticorps frs3, anticorps Frs3

Sujet: FRS3 is an adapter protein that links FGR and NGF receptors to downstream signaling pathways. FRS3 is involved in the activation of MAP kinases. FRS3 down-regulates ERK2 signaling by interfering with the phosphorylation and nuclear translocation of ERK2.

Poids moléculaire: 54 kDa (MW of target protein)