CAD anticorps (C-Term)
-
- Antigène Voir toutes CAD Anticorps
- CAD (Carbamoyl-Phosphate Synthetase 2, Aspartate Transcarbamylase, and Dihydroorotase (CAD))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CAD est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CAD antibody was raised against the C terminal of CAD
- Purification
- Affinity purified
- Immunogène
- CAD antibody was raised using the C terminal of CAD corresponding to a region with amino acids ADVVVLRHPQPGAVELAAKHCRRPVINAGDGVGEHPTQALLDIFTIREEL
- Top Product
- Discover our top product CAD Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CAD Blocking Peptide, catalog no. 33R-1109, is also available for use as a blocking control in assays to test for specificity of this CAD antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAD antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CAD (Carbamoyl-Phosphate Synthetase 2, Aspartate Transcarbamylase, and Dihydroorotase (CAD))
- Autre désignation
- CAD (CAD Produits)
- Synonymes
- anticorps Cpad, anticorps AU018859, anticorps 2410008J01Rik, anticorps cb456, anticorps wu:fc30c12, anticorps wu:fc33d01, anticorps wu:fc67g02, anticorps si:dkey-221h15.3, anticorps CAD, anticorps xcad, anticorps carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase, anticorps CAD, anticorps Cad, anticorps cad
- Sujet
- CAD is a trifunctional protein which is associated with the enzymatic activities of the first 3 enzymes in the 6-step pathway of pyrimidine biosynthesis: carbamoylphosphate synthetase (CPS II), aspartate transcarbamoylase, and dihydroorotase. This protein is regulated by the mitogen-activated protein kinase (MAPK) cascade, which indicates a direct link between activation of the MAPK cascade and de novo biosynthesis of pyrimidine nucleotides.
- Poids moléculaire
- 243 kDa (MW of target protein)
- Pathways
- Production of Molecular Mediator of Immune Response, Ribonucleoside Biosynthetic Process
-