STRADA anticorps (C-Term)

N° du produit ABIN630667

Détail du produit anti-STRADA anticorps

Antigène: STRADA (STE20-Related Kinase Adaptor alpha (STRADA))

Épitope: C-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp STRADA est non-conjugé

Application: Western Blotting (WB)

Specificité: LYK5 antibody was raised against the C terminal of LYK5

Purification: Affinity purified

Immunogène: LYK5 antibody was raised using the C terminal of LYK5 corresponding to a region with amino acids AEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFV

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LYK5 Blocking Peptide, catalog no. 33R-1125, is also available for use as a blocking control in assays to test for specificity of this LYK5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYK5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur STRADA

Antigène: STRADA (STE20-Related Kinase Adaptor alpha (STRADA))

Autre désignation: LYK5 (STRADA Produits)

Synonymes: anticorps fj99g05, anticorps zgc:56109, anticorps wu:fj99g05, anticorps lyk5, anticorps LYK5, anticorps NY-BR-96, anticorps PMSE, anticorps STRAD, anticorps Stlk, anticorps Lyk5, anticorps 2610019A05Rik, anticorps 6030402H20Rik, anticorps AI480680, anticorps E130112C09Rik, anticorps STE20-related kinase adaptor alpha, anticorps ste20-related kinase adaptor alpha, anticorps STRADA, anticorps strada, anticorps Strada

Sujet: LYK5 belongs to the protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily. It contains 1 protein kinase domain. LYK5 is a pseudokinase which, in complex with CAB39, binds to and activates STK11.

Poids moléculaire: 44 kDa (MW of target protein)

Pathways: AMPK Signaling