RSF1 anticorps (Middle Region)

N° du produit ABIN630684

Détail du produit anti-RSF1 anticorps

Antigène: RSF1 (Remodeling and Spacing Factor 1 (RSF1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RSF1 est non-conjugé

Application: Western Blotting (WB)

Specificité: RSF1 antibody was raised against the middle region of RSF1

Purification: Affinity purified

Immunogène: RSF1 antibody was raised using the middle region of RSF1 corresponding to a region with amino acids QDEFVVSDENPDESEEDPPSNDDSDTDFCSRRLRRHPSRPMRQSRRLRRK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RSF1 Blocking Peptide, catalog no. 33R-7494, is also available for use as a blocking control in assays to test for specificity of this RSF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RSF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RSF1

Antigène: RSF1 (Remodeling and Spacing Factor 1 (RSF1))

Autre désignation: RSF1 (RSF1 Produits)

Synonymes: anticorps Rsf-1, anticorps CG5655, anticorps Dmel\\CG5655, anticorps ROX21, anticorps RSF1, anticorps Rox21, anticorps rox21, anticorps hbxap, anticorps HBXAP, anticorps RSF-1, anticorps XAP8, anticorps p325, anticorps 4832420A03Rik, anticorps C030033M12Rik, anticorps Gm164, anticorps Hbxap, anticorps remodeling and spacing factor 1, anticorps Repressor splicing factor 1, anticorps remodeling and spacing factor 1 S homeolog, anticorps RSF1, anticorps Rsf1, anticorps rsf1.S

Sujet: RSF1 (HBXAP) is involved in transcription repression, transcription coactivation when associated with hepatitis B virus X protein (HBX), and chromatin remodeling and spacing when associated with SNF2H.HBXAP is involved in transcription repression, transcription coactivation when associated with hepatitis B virus X protein (HBX), and chromatin remodeling and spacing when associated with SNF2H.

Poids moléculaire: 164 kDa (MW of target protein)