TTC5 anticorps (C-Term)

N° du produit ABIN630694

Détail du produit anti-TTC5 anticorps

Antigène: TTC5 (Tetratricopeptide Repeat Domain 5 (TTC5))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TTC5 est non-conjugé

Application: Western Blotting (WB)

Specificité: TTC5 antibody was raised against the C terminal of TTC5

Purification: Affinity purified

Immunogène: TTC5 antibody was raised using the C terminal of TTC5 corresponding to a region with amino acids GDSVAIPEPNLRLHRIQHKGKDYSFSSVRVETPLLLVVNGKPQGSSSQAV

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TTC5 Blocking Peptide, catalog no. 33R-3213, is also available for use as a blocking control in assays to test for specificity of this TTC5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTC5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TTC5

Antigène: TTC5 (Tetratricopeptide Repeat Domain 5 (TTC5))

Autre désignation: TTC5 (TTC5 Produits)

Synonymes: anticorps TTC5, anticorps ttc5, anticorps wu:fi33h05, anticorps wu:fy81e07, anticorps zgc:112059, anticorps Strap, anticorps 5930437N14, anticorps AW743060, anticorps tetratricopeptide repeat domain 5 L homeolog, anticorps tetratricopeptide repeat domain 5, anticorps ttc5.L, anticorps TTC5, anticorps ttc5, anticorps Ttc5

Sujet: TTC5 is an adapter protein involved in p53/TP53 response that acts by regulating and mediating the assembly of multi-protein complexes. It is required to facilitate the interaction between JMY and p300/EP300 and increase p53/TP53-dependent transcription and apoptosis. It prevents p53/TP53 degradation by MDM2.

Poids moléculaire: 49 kDa (MW of target protein)

Pathways: Chromatin Binding