NUSAP1 anticorps (Middle Region)
-
- Antigène Voir toutes NUSAP1 Anticorps
- NUSAP1 (Nucleolar and Spindle Associated Protein 1 (NUSAP1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NUSAP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NUSAP1 antibody was raised against the middle region of NUSAP1
- Purification
- Affinity purified
- Immunogène
- NUSAP1 antibody was raised using the middle region of NUSAP1 corresponding to a region with amino acids AENAVSSGNRDSKVPSEGKKSLYTDESSKPGKNKRTAITTPNFKKLHEAH
- Top Product
- Discover our top product NUSAP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NUSAP1 Blocking Peptide, catalog no. 33R-1139, is also available for use as a blocking control in assays to test for specificity of this NUSAP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUSAP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NUSAP1 (Nucleolar and Spindle Associated Protein 1 (NUSAP1))
- Autre désignation
- NUSAP1 (NUSAP1 Produits)
- Synonymes
- anticorps ANKT, anticorps BM037, anticorps LNP, anticorps NUSAP, anticorps PRO0310p1, anticorps Q0310, anticorps SAPL, anticorps 2610201A12Rik, anticorps AI481307, anticorps AW547774, anticorps BB165529, anticorps NuSAP, anticorps YF-9, anticorps ankt, anticorps fb76a01, anticorps fi37a11, anticorps sb:cb490, anticorps wu:fb76a01, anticorps wu:fi37a11, anticorps lnp, anticorps nusap, anticorps nusap1, anticorps sapl, anticorps nucleolar and spindle associated protein 1, anticorps nucleolar and spindle associated protein 1 L homeolog, anticorps nucleolar and spindle associated protein 1 S homeolog, anticorps NUSAP1, anticorps Nusap1, anticorps nusap1, anticorps nusap1.L, anticorps nusap1.S
- Sujet
- NUSAP1 is a microtubule-associated protein with the capacity to bundle and stabilize microtubules. It may associate with chromosomes and promote the organization of mitotic spindle microtubules around them.
- Poids moléculaire
- 49 kDa (MW of target protein)
-