POLR3A anticorps (Middle Region)

N° du produit ABIN630732

Détail du produit anti-POLR3A anticorps

Antigène: POLR3A (Polymerase (RNA) III (DNA Directed) Polypeptide A, 155kDa (POLR3A))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp POLR3A est non-conjugé

Application: Western Blotting (WB)

Specificité: POLR3 A antibody was raised against the middle region of POLR3

Purification: Affinity purified

Immunogène: POLR3 A antibody was raised using the middle region of POLR3 corresponding to a region with amino acids AYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADRDPNPPKRPLIFDT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

POLR3A Blocking Peptide, catalog no. 33R-1627, is also available for use as a blocking control in assays to test for specificity of this POLR3A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur POLR3A

Antigène: POLR3A (Polymerase (RNA) III (DNA Directed) Polypeptide A, 155kDa (POLR3A))

Autre désignation: POLR3A (POLR3A Produits)

Synonymes: anticorps 9330175N20Rik, anticorps BC053071, anticorps RPC1, anticorps RPC155, anticorps RGD1305574, anticorps ADDH, anticorps HLD7, anticorps hRPC155, anticorps polymerase (RNA) III (DNA directed) polypeptide A, anticorps RNA polymerase III subunit A, anticorps Polr3a, anticorps POLR3A

Sujet: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR3A is the largest and catalytic core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. It forms the polymerase active center together with the second largest subunit. A single stranded DNA template strand of the promoter is positioned within the central active site cleft of Pol III. A bridging helix emanates from RPC1 and crosses the cleft near the catalytic site and is thought to promote translocation of Pol III by acting as a ratchet that moves the RNA-DNA hybrid through the active site by switching from straight to bent conformations at each step of nucleotide addition.

Poids moléculaire: 156 kDa (MW of target protein)