RAP1GAP anticorps (Middle Region)

N° du produit ABIN630756

Détail du produit anti-RAP1GAP anticorps

Antigène: RAP1GAP (RAP1 GTPase Activating Protein (RAP1GAP))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAP1GAP est non-conjugé

Application: Western Blotting (WB)

Specificité: RAP1 GAP antibody was raised against the middle region of RAP1 AP

Purification: Affinity purified

Immunogène: RAP1 GAP antibody was raised using the middle region of RAP1 AP corresponding to a region with amino acids IENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAP1GAP Blocking Peptide, catalog no. 33R-3948, is also available for use as a blocking control in assays to test for specificity of this RAP1GAP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAP0 AP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAP1GAP

Antigène: RAP1GAP (RAP1 GTPase Activating Protein (RAP1GAP))

Autre désignation: RAP1GAP (RAP1GAP Produits)

Synonymes: anticorps RAP1GA1, anticorps RAP1GAP1, anticorps RAP1GAPII, anticorps RAPGAP, anticorps 1300019I11Rik, anticorps 2310004O14Rik, anticorps AI427470, anticorps Rap1ga1, anticorps RAP1, anticorps RAP1GAP, anticorps rap1ga1, anticorps rap1gap1, anticorps rap1gapii, anticorps rapgap, anticorps zgc:175180, anticorps DKFZp459A114, anticorps RAP1 GTPase activating protein, anticorps Rap1 GTPase-activating protein, anticorps RAP1 GTPase activating protein 1, anticorps RAP1 GTPase activating protein L homeolog, anticorps Rap1 GTPase-activating protein 1, anticorps si:dkey-166d12.2, anticorps RAP1GAP, anticorps Rap1gap, anticorps RAP1GAP1, anticorps rap1gap.L, anticorps Tsp_09520, anticorps rap1gap, anticorps si:dkey-166d12.2

Sujet: RAP1GAP is the GTPase activator for the nuclear Ras-related regulatory protein RAP-1A (KREV-1), converting it to the putatively inactive GDP-bound state.

Poids moléculaire: 73 kDa (MW of target protein)