RALGPS2 anticorps (N-Term)
-
- Antigène Voir toutes RALGPS2 Anticorps
- RALGPS2 (Ral GEF with PH Domain and SH3 Binding Motif 2 (RALGPS2))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RALGPS2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RALGPS2 antibody was raised against the n terminal of RALGPS2
- Purification
- Affinity purified
- Immunogène
- RALGPS2 antibody was raised using the N terminal of RALGPS2 corresponding to a region with amino acids MDLMNGQASSVNIAATASEKSSSSESLSDKGSELKKSFDAVVFDVLKVTP
- Top Product
- Discover our top product RALGPS2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RALGPS2 Blocking Peptide, catalog no. 33R-5849, is also available for use as a blocking control in assays to test for specificity of this RALGPS2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RALGPS2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RALGPS2 (Ral GEF with PH Domain and SH3 Binding Motif 2 (RALGPS2))
- Autre désignation
- RALGPS2 (RALGPS2 Produits)
- Synonymes
- anticorps RALGPS1, anticorps RALGPS2, anticorps dJ595C2.1, anticorps 1810020P17Rik, anticorps 2210408F11Rik, anticorps 4921528G01Rik, anticorps 9130014M22Rik, anticorps AU043409, anticorps AW046161, anticorps Ral GEF with PH domain and SH3 binding motif 2, anticorps RALGPS2, anticorps ralgps2, anticorps Ralgps2
- Sujet
- RALGPS2 is a guanine nucleotide exchange factor for the small GTPase RALA. RALGPS2 may be involved in cytoskeletal organization. RALGPS2 may also be involved in the stimulation of transcription in a Ras-independent fashion.
- Poids moléculaire
- 32 kDa (MW of target protein)
-