MPP7 anticorps
-
- Antigène Voir toutes MPP7 Anticorps
- MPP7 (Membrane Protein, Palmitoylated 7 (MAGUK p55 Subfamily Member 7) (MPP7))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MPP7 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- MPP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids MPALSTGSGSDTGLYELLAALPAQLQPHVDSQEDLTFLWDMFGEKSLHSL
- Top Product
- Discover our top product MPP7 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MPP7 Blocking Peptide, catalog no. 33R-6270, is also available for use as a blocking control in assays to test for specificity of this MPP7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPP7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MPP7 (Membrane Protein, Palmitoylated 7 (MAGUK p55 Subfamily Member 7) (MPP7))
- Autre désignation
- MPP7 (MPP7 Produits)
- Synonymes
- anticorps 1110068J02Rik, anticorps 2810038M04Rik, anticorps 5430426E14Rik, anticorps AI415104, anticorps Gm955, anticorps dlg3, anticorps hmp, anticorps membrane palmitoylated protein 7, anticorps membrane protein, palmitoylated 7 (MAGUK p55 subfamily member 7), anticorps membrane protein, palmitoylated 7a (MAGUK p55 subfamily member 7), anticorps MPP7, anticorps Mpp7, anticorps mpp7a
- Sujet
- MPP7 acts as an important adapter that promotes epithelial cell polarity and tight junction formation via its interaction with DLG1. MPP7 is involved in the assembly of protein complexes at sites of cell-cell contact.
- Poids moléculaire
- 65 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization
-