CA1 anticorps (N-Term)

N° du produit ABIN630776

Détail du produit anti-CA1 anticorps

Antigène: CA1 (Carbonic Anhydrase I (CA1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CA1 est non-conjugé

Application: Western Blotting (WB)

Specificité: Carbonic Anhydrase I antibody was raised against the N terminal of CA1

Purification: Affinity purified

Immunogène: Carbonic Anhydrase I antibody was raised using the N terminal of CA1 corresponding to a region with amino acids ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Carbonic Anhydrase I Blocking Peptide, catalog no. 33R-1519, is also available for use as a blocking control in assays to test for specificity of this Carbonic Anhydrase I antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CA1

Antigène: CA1 (Carbonic Anhydrase I (CA1))

Autre désignation: Carbonic Anhydrase I (CA1 Produits)

Synonymes: anticorps CA-I, anticorps CAB, anticorps Car1, anticorps AW555628, anticorps Ca1, anticorps Car-1, anticorps BG:DS00941.1, anticorps CAH, anticorps CG7820, anticorps Dmel\\CG7820, anticorps Gh7, anticorps ARABIDOPSIS THALIANA SALICYLIC ACID-BINDING PROTEIN 3, anticorps ATBCA1, anticorps ATSABP3, anticorps BETA CARBONIC ANHYDRASE 1, anticorps F4P13.5, anticorps F4P13_5, anticorps SABP3, anticorps SALICYLIC ACID-BINDING PROTEIN 3, anticorps carbonic anhydrase 1, anticorps CA1, anticorps LOC100135826, anticorps GB15888, anticorps carbonic anhydrase 1, anticorps Carbonic anhydrase 1, anticorps carbonic anhydrase I, anticorps carbonic anhydrase, anticorps CA1, anticorps Car1, anticorps CAH1, anticorps LOC100135826, anticorps LOC408827, anticorps Tsp_05114, anticorps LOC100153915, anticorps LOC100050192, anticorps Ca1

Sujet: Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA1 is closely linked to CA2 and CA3 genes on chromosome 8, and it encodes a cytosolic protein which is found at the highest level in erythrocytes.

Poids moléculaire: 29 kDa (MW of target protein)