SPTAN1 anticorps

N° du produit ABIN630780

Détail du produit anti-SPTAN1 anticorps

Antigène: SPTAN1 (Spectrin alpha Chain, Brain (SPTAN1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SPTAN1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SPTAN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SPTAN1 Blocking Peptide, catalog no. 33R-5860, is also available for use as a blocking control in assays to test for specificity of this SPTAN1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPTAN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SPTAN1

Antigène: SPTAN1 (Spectrin alpha Chain, Brain (SPTAN1))

Autre désignation: SPTAN1 (SPTAN1 Produits)

Synonymes: anticorps im:7157190, anticorps wu:fa20e05, anticorps wu:fb33g08, anticorps wu:fk32a10, anticorps zgc:112229, anticorps 2610027H02Rik, anticorps Spna-2, anticorps Spna2, anticorps EIEE5, anticorps NEAS, anticorps SPTA2, anticorps A2a, anticorps IPF, anticorps SPECA, anticorps spectrin alpha, non-erythrocytic 1, anticorps spectrin, alpha, non-erythrocytic 1, anticorps SPTAN1, anticorps sptan1, anticorps Sptan1

Sujet: Fodrin (SPTAN1), which seems to be involved in secretion, interacts with calmodulin in a calcium-dependent manner and is thus candidate for the calcium-dependent movement of the cytoskeleton at the membrane.

Poids moléculaire: 272 kDa (MW of target protein)

Pathways: Caspase Cascade in Apoptosis, Regulation of Actin Filament Polymerization