Septin 9 anticorps (C-Term)

N° du produit ABIN630783

Cet anticorps anti-Septin 9 Polyclonal Lapin (ABIN630783) détecte spécifiquement Septin 9 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour Septin 9 anticorps (C-Term) (ABIN630783)

Antigène: Septin 9 (SEPT9)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Septin 9 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Septin 9 anticorps

Épitope: C-Term

Specificité: Septin 9 antibody was raised against the C terminal of 40430

Purification: Affinity purified

Immunogène: Septin 9 antibody was raised using the C terminal of 40430 corresponding to a region with amino acids HCEFAYLRDLLIRTHMQNIKDITSSIHFEAYRVKRLNEGSSAMANGMEEK

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 40057 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Septin 9

Antigène: Septin 9 (SEPT9)

Autre désignation: Septin 9

Sujet: Septin-9 is a member of the septin family, which contains cytoplasmic cytoskeletal filament-forming proteins that have a conserved GTP-binding domain.

Poids moléculaire: 37 kDa (MW of target protein)