Septin 9 anticorps (C-Term)

N° du produit ABIN630783

Détail du produit anti-Septin 9 anticorps

Antigène: Septin 9 (SEPT9)

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Septin 9 est non-conjugé

Application: Western Blotting (WB)

Specificité: Septin 9 antibody was raised against the C terminal of 40430

Purification: Affinity purified

Immunogène: Septin 9 antibody was raised using the C terminal of 40430 corresponding to a region with amino acids HCEFAYLRDLLIRTHMQNIKDITSSIHFEAYRVKRLNEGSSAMANGMEEK

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 40057 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Septin 9

Antigène: Septin 9 (SEPT9)

Autre désignation: Septin 9 (SEPT9 Produits)

Synonymes: anticorps SEPT9, anticorps msf, anticorps msf1, anticorps napb, anticorps sint1, anticorps pnutl4, anticorps septd1, anticorps af17q25, anticorps septin-9, anticorps AF17q25, anticorps MSF, anticorps MSF1, anticorps NAPB, anticorps PNUTL4, anticorps SINT1, anticorps SeptD1, anticorps Msf, anticorps Sint1, anticorps Eseptin, anticorps Slpa, anticorps cb999, anticorps fb02h06, anticorps sept9, anticorps wu:fb02h06, anticorps septin 9, anticorps septin-9, anticorps septin 9 S homeolog, anticorps septin 9a, anticorps SEPT9, anticorps sept9, anticorps LOC100605286, anticorps sept9.S, anticorps Sept9, anticorps sept9a

Sujet: Septin-9 is a member of the septin family, which contains cytoplasmic cytoskeletal filament-forming proteins that have a conserved GTP-binding domain.

Poids moléculaire: 37 kDa (MW of target protein)