GABARAP anticorps
-
- Antigène Voir toutes GABARAP Anticorps
- GABARAP (GABA(A) Receptor-Associated Protein (GABARAP))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GABARAP est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- GABARAP antibody was raised using a synthetic peptide corresponding to a region with amino acids KFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLV
- Top Product
- Discover our top product GABARAP Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GABARAP Blocking Peptide, catalog no. 33R-4382, is also available for use as a blocking control in assays to test for specificity of this GABARAP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABARAP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GABARAP (GABA(A) Receptor-Associated Protein (GABARAP))
- Autre désignation
- GABARAP (GABARAP Produits)
- Synonymes
- anticorps GABARAP, anticorps ATG8A, anticorps GABARAP-a, anticorps MM46, anticorps gabarap, anticorps mg:bb02b03, anticorps GABA type A receptor-associated protein, anticorps gamma-aminobutyric acid receptor-associated protein, anticorps GABA(A) receptor-associated protein a, anticorps gamma-aminobutyric acid receptor associated protein, anticorps GABARAP, anticorps LOC5568843, anticorps Gabarap, anticorps gabarapa
- Sujet
- Gamma-aminobutyric acid A receptors [GABA(A) receptors] are ligand-gated chloride channels that mediate inhibitory neurotransmission. GABA(A) receptor-associated protein (GABARAP) is highly positively charged in its N-terminus and shares sequence similarity with light chain-3 of microtubule-associated proteins 1A and 1B. This protein clusters neurotransmitter receptors by mediating interaction with the cytoskeleton.
- Poids moléculaire
- 14 kDa (MW of target protein)
- Pathways
- Autophagy
-