GABARAP anticorps

N° du produit ABIN630786

Cet anticorps anti-GABARAP Polyclonal Lapin (ABIN630786) détecte spécifiquement GABARAP dans WB. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour GABARAP anticorps (ABIN630786)

Antigène: GABARAP (GABA(A) Receptor-Associated Protein (GABARAP))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GABARAP est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GABARAP anticorps

Purification: Affinity purified

Immunogène: GABARAP antibody was raised using a synthetic peptide corresponding to a region with amino acids KFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GABARAP Blocking Peptide, (ABIN939768), is also available for use as a blocking control in assays to test for specificity of this GABARAP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABARAP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GABARAP

Antigène: GABARAP (GABA(A) Receptor-Associated Protein (GABARAP))

Autre désignation: GABARAP

Sujet: Gamma-aminobutyric acid A receptors [GABA(A) receptors] are ligand-gated chloride channels that mediate inhibitory neurotransmission. GABA(A) receptor-associated protein (GABARAP) is highly positively charged in its N-terminus and shares sequence similarity with light chain-3 of microtubule-associated proteins 1A and 1B. This protein clusters neurotransmitter receptors by mediating interaction with the cytoskeleton.

Poids moléculaire: 14 kDa (MW of target protein)

Pathways: Autophagy