LCP1 anticorps
-
- Antigène Voir toutes LCP1 Anticorps
- LCP1 (Lymphocyte Cytosolic Protein 1 (LCP1))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LCP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK
- Top Product
- Discover our top product LCP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LCP1 Blocking Peptide, catalog no. 33R-2929, is also available for use as a blocking control in assays to test for specificity of this LCP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LCP1 (Lymphocyte Cytosolic Protein 1 (LCP1))
- Autre désignation
- LCP1 (LCP1 Produits)
- Synonymes
- anticorps CP64, anticorps L-PLASTIN, anticorps LC64P, anticorps LPL, anticorps PLS2, anticorps cb245, anticorps fj24b12, anticorps wu:fj24b12, anticorps cp64, anticorps l-plastin, anticorps lc64p, anticorps lpl, anticorps pls2, anticorps plastin-2, anticorps AW536232, anticorps D14Ertd310e, anticorps LCP-1, anticorps Pls2, anticorps pp65, anticorps lymphocyte cytosolic protein 1, anticorps lymphocyte cytosolic protein 1 (L-plastin), anticorps lymphocyte cytosolic protein 1 (L-plastin) S homeolog, anticorps lower matrix protein; involved in immune regulation, anticorps LCP1, anticorps lcp1, anticorps lcp1.S, anticorps Lcp1, anticorps UL83
- Sujet
- Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. The L isoform is expressed only in hemopoietic cell lineages. However, L-plastin has been found in many types of malignant human cells of non-hemopoietic origin suggesting that its expression is induced accompanying tumorigenesis in solid tissues.
- Poids moléculaire
- 70 kDa (MW of target protein)
-