LCP1 anticorps

N° du produit ABIN630794

Détail du produit anti-LCP1 anticorps

Antigène: LCP1 (Lymphocyte Cytosolic Protein 1 (LCP1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LCP1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LCP1 Blocking Peptide, catalog no. 33R-2929, is also available for use as a blocking control in assays to test for specificity of this LCP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LCP1

Antigène: LCP1 (Lymphocyte Cytosolic Protein 1 (LCP1))

Autre désignation: LCP1 (LCP1 Produits)

Synonymes: anticorps CP64, anticorps L-PLASTIN, anticorps LC64P, anticorps LPL, anticorps PLS2, anticorps cb245, anticorps fj24b12, anticorps wu:fj24b12, anticorps cp64, anticorps l-plastin, anticorps lc64p, anticorps lpl, anticorps pls2, anticorps plastin-2, anticorps AW536232, anticorps D14Ertd310e, anticorps LCP-1, anticorps Pls2, anticorps pp65, anticorps lymphocyte cytosolic protein 1, anticorps lymphocyte cytosolic protein 1 (L-plastin), anticorps lymphocyte cytosolic protein 1 (L-plastin) S homeolog, anticorps lower matrix protein; involved in immune regulation, anticorps LCP1, anticorps lcp1, anticorps lcp1.S, anticorps Lcp1, anticorps UL83

Sujet: Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. The L isoform is expressed only in hemopoietic cell lineages. However, L-plastin has been found in many types of malignant human cells of non-hemopoietic origin suggesting that its expression is induced accompanying tumorigenesis in solid tissues.

Poids moléculaire: 70 kDa (MW of target protein)