HSPH1 anticorps (Middle Region)

N° du produit ABIN630808

Détail du produit anti-HSPH1 anticorps

Antigène: HSPH1 (Heat Shock 105kDa/110kDa Protein 1 (HSPH1))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HSPH1 est non-conjugé

Application: Western Blotting (WB)

Specificité: HSPH1 antibody was raised against the middle region of HSPH1

Purification: Affinity purified

Immunogène: HSPH1 antibody was raised using the middle region of HSPH1 corresponding to a region with amino acids EENEMSSEADMECLNQRPPENPDTDKNVQQDNSEAGTQPQVQTDAQQTSQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HSPH1 Blocking Peptide, catalog no. 33R-2377, is also available for use as a blocking control in assays to test for specificity of this HSPH1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HSPH1

Antigène: HSPH1 (Heat Shock 105kDa/110kDa Protein 1 (HSPH1))

Autre désignation: HSPH1 (HSPH1 Produits)

Synonymes: anticorps hsp105, anticorps hsp105a, anticorps hsp105b, anticorps hsp110, anticorps hsph1b, anticorps Hsp105, anticorps HSP105, anticorps HSP105A, anticorps HSP105B, anticorps NY-CO-25, anticorps 105kDa, anticorps AI790491, anticorps Hsp110, anticorps hsp-E7I, anticorps hsph1, anticorps hsph1a, anticorps heat shock protein family H (Hsp110) member 1, anticorps heat shock protein family H (Hsp110) member 1 S homeolog, anticorps heat shock protein 105 kDa, anticorps heat shock 105kDa/110kDa protein 1, anticorps heat shock protein family H (Hsp110) member 1 L homeolog, anticorps hsph1, anticorps hsph1.S, anticorps HSPH1, anticorps LOC100546590, anticorps Hsph1, anticorps hsph1.L

Sujet: HSPH1 prevents the aggregation of denatured proteins in cells under severe stress, on which the ATP levels decrease markedly. It inhibits HSPA8/HSC70 ATPase and chaperone activities.

Poids moléculaire: 97 kDa (MW of target protein)