TRIM37 anticorps (Middle Region)

N° du produit ABIN630817

Détail du produit anti-TRIM37 anticorps

Antigène: TRIM37 (Tripartite Motif Containing 37 (TRIM37))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRIM37 est non-conjugé

Application: Western Blotting (WB)

Specificité: TRIM37 antibody was raised against the middle region of TRIM37

Purification: Affinity purified

Immunogène: TRIM37 antibody was raised using the middle region of TRIM37 corresponding to a region with amino acids GMSSDSDIECDTENEEQEEHTSVGGFHDSFMVMTQPPDEDTHSSFPDGEQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRIM37 Blocking Peptide, catalog no. 33R-3441, is also available for use as a blocking control in assays to test for specificity of this TRIM37 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM37 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRIM37

Antigène: TRIM37 (Tripartite Motif Containing 37 (TRIM37))

Autre désignation: TRIM37 (TRIM37 Produits)

Synonymes: anticorps MUL, anticorps POB1, anticorps TEF3, anticorps 1110032A10Rik, anticorps 2810004E07Rik, anticorps AI848587, anticorps AU043018, anticorps mKIAA0898, anticorps tripartite motif-containing 37, anticorps tripartite motif containing 37, anticorps Trim37, anticorps TRIM37

Sujet: This gene encodes a member of the tripartite motif (TRIM) family, whose members are involved in diverse cellular functions such as developmental patterning and oncogenesis.

Poids moléculaire: 108 kDa (MW of target protein)