TLR6 anticorps (Middle Region)

N° du produit ABIN630842

Détail du produit anti-TLR6 anticorps

Antigène: TLR6 (Toll-Like Receptor 6 (TLR6))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TLR6 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: TLR6 antibody was raised against the middle region of TLR6

Purification: Affinity purified

Immunogène: TLR6 antibody was raised using the middle region of TLR6 corresponding to a region with amino acids KCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYSKTTLKALTIEHIT

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TLR6 Blocking Peptide, catalog no. 33R-4273, is also available for use as a blocking control in assays to test for specificity of this TLR6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TLR6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TLR6

Antigène: TLR6 (Toll-Like Receptor 6 (TLR6))

Autre désignation: TLR6 (TLR6 Produits)

Synonymes: anticorps TLR1, anticorps TLR16, anticorps CD286, anticorps TLR-6, anticorps toll-like receptor 1 family member A, anticorps toll like receptor 6, anticorps toll-like receptor 6, anticorps TLR1A, anticorps TLR6, anticorps Tlr6

Sujet: TLR6 is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognise pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This receptor functionally interacts with toll-like receptor 2 to mediate cellular response to bacterial lipoproteins.

Poids moléculaire: 53 kDa (MW of target protein)

Pathways: Signalisation TLR, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Toll-Like Receptors Cascades