SYCP3 anticorps (N-Term)

N° du produit ABIN630844

Détail du produit anti-SYCP3 anticorps

Antigène: SYCP3 (Synaptonemal Complex Protein 3 (SYCP3))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SYCP3 est non-conjugé

Application: Western Blotting (WB)

Specificité: SYCP3 antibody was raised against the N terminal of SYCP3

Purification: Affinity purified

Immunogène: SYCP3 antibody was raised using the N terminal of SYCP3 corresponding to a region with amino acids VSSGKKYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SYCP3 Blocking Peptide, catalog no. 33R-9825, is also available for use as a blocking control in assays to test for specificity of this SYCP3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYCP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SYCP3

Antigène: SYCP3 (Synaptonemal Complex Protein 3 (SYCP3))

Autre désignation: SYCP3 (SYCP3 Produits)

Synonymes: anticorps Cor1, anticorps Scp3, anticorps COR1, anticorps SCP3, anticorps SPGF4, anticorps RNASCP3, anticorps SYCP3, anticorps sycp3, anticorps MGC146429, anticorps scp3, anticorps SCP-3, anticorps synaptonemal complex protein 3, anticorps synaptonemal complex protein 3 L homeolog, anticorps Sycp3, anticorps SYCP3, anticorps sycp3, anticorps scp3, anticorps sycp3.L

Sujet: SYCP3 is a component of the transverse filaments of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. It has an essential meiotic function in spermatogenesis. SYCP3 may be important for testis development.

Poids moléculaire: 26 kDa (MW of target protein)