UPB1 anticorps (Middle Region)
-
- Antigène Voir toutes UPB1 Anticorps
- UPB1 (Ureidopropionase, beta (UPB1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp UPB1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- UPB1 antibody was raised against the middle region of UPB1
- Purification
- Affinity purified
- Immunogène
- UPB1 antibody was raised using the middle region of UPB1 corresponding to a region with amino acids NRVGTEHFPNEFTSGDGKKAHQDFGYFYGSSYVAAPDSSRTPGLSRSRDG
- Top Product
- Discover our top product UPB1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
UPB1 Blocking Peptide, catalog no. 33R-6866, is also available for use as a blocking control in assays to test for specificity of this UPB1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UPB1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- UPB1 (Ureidopropionase, beta (UPB1))
- Autre désignation
- UPB1 (UPB1 Produits)
- Synonymes
- anticorps MGC82230, anticorps wu:fb69e03, anticorps zgc:64020, anticorps BUP1, anticorps AI195023, anticorps Bup1, anticorps ureidopropionase, beta S homeolog, anticorps beta-ureidopropionase 1, anticorps ureidopropionase, beta, anticorps UreidoPropionase Beta, anticorps upb1.S, anticorps UPB1, anticorps upb1, anticorps upb-1, anticorps Upb1
- Sujet
- UPB1 is a protein that belongs to the CN hydrolase family. Beta-ureidopropionase catalyzes the last step in the pyrimidine degradation pathway.
- Poids moléculaire
- 43 kDa (MW of target protein)
-