DCLRE1C anticorps

N° du produit ABIN630862

Détail du produit anti-DCLRE1C anticorps

Antigène: DCLRE1C (DNA Cross-Link Repair 1C (DCLRE1C))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DCLRE1C est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DCLRE1 C antibody was raised using a synthetic peptide corresponding to a region with amino acids SSFEGQMAEYPTISIDRFDRENLRARAYFLSHCHKDHMKGLRAPTLKRRL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DCLRE1C Blocking Peptide, catalog no. 33R-8799, is also available for use as a blocking control in assays to test for specificity of this DCLRE1C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCLRE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DCLRE1C

Antigène: DCLRE1C (DNA Cross-Link Repair 1C (DCLRE1C))

Autre désignation: DCLRE1C (DCLRE1C Produits)

Synonymes: anticorps artemis, anticorps A-SCID, anticorps DCLREC1C, anticorps RS-SCID, anticorps SCIDA, anticorps SNM1C, anticorps hSNM1C, anticorps Snm1l, anticorps nuclease, anticorps 9930121L06Rik, anticorps AI661365, anticorps Art, anticorps DNA cross-link repair 1C, anticorps DCLRE1C, anticorps Dclre1c

Sujet: DCLRE1C is a nuclear protein that is involved in V(D)J recombination and DNA repair. The protein has single-strand-specific 5'-3' exonuclease activity, it also exhibits endonuclease activity on 5' and 3' overhangs and hairpins when complexed with protein kinase, DNA-activated, catalytic polypeptide. Mutations in this gene cause Athabascan-type severe combined immunodeficiency (SCIDA).

Poids moléculaire: 78 kDa (MW of target protein)

Pathways: Réparation de l'ADN