TNKS1BP1 anticorps (Middle Region)

N° du produit ABIN630864

Détail du produit anti-TNKS1BP1 anticorps

Antigène: TNKS1BP1 (Tankyrase 1 Binding Protein 1, 182kDa (TNKS1BP1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TNKS1BP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: TNKS1 BP1 antibody was raised against the middle region of TNKS1 P1

Purification: Affinity purified

Immunogène: TNKS1 BP1 antibody was raised using the middle region of TNKS1 P1 corresponding to a region with amino acids DGEASQTEDVDGTWGSSAARWSDQGPAQTSRRPSQGPPARSPSQDFSFIE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TNKS1BP1 Blocking Peptide, catalog no. 33R-1945, is also available for use as a blocking control in assays to test for specificity of this TNKS1BP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNKS0 P1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TNKS1BP1

Antigène: TNKS1BP1 (Tankyrase 1 Binding Protein 1, 182kDa (TNKS1BP1))

Autre désignation: TNKS1BP1 (TNKS1BP1 Produits)

Synonymes: anticorps TAB182, anticorps Tab182, anticorps mKIAA1741, anticorps tankyrase 1 binding protein 1, anticorps 182 kDa tankyrase-1-binding protein, anticorps TNKS1BP1, anticorps LOC100625088, anticorps Tnks1bp1

Sujet: TNKS-1 mRNA in urine sediment from patients with bladder TCC correlated with tumor stage, and higher preoperative levels were associated with increased risk of early recurrence. Tankyrase-1 is required in the assembly of bipolar spindles and the spindle-pole protein NuMA as a substrate for covalent modification by tankyrase-1. Data also show that tankyrase 1 inhibition in human cancer cells enhances telomere shortening by a telomerase inhibitor and hastens cell death.

Poids moléculaire: 190 kDa (MW of target protein)