FANCE anticorps (Middle Region)

N° du produit ABIN630869

Détail du produit anti-FANCE anticorps

Antigène: FANCE (Fanconi Anemia, Complementation Group E (FANCE))

Épitope: AA 1-13, Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FANCE est non-conjugé

Application: Western Blotting (WB)

Specificité: FANCE antibody was raised against the middle region of FANCE

Purification: Affinity purified

Immunogène: FANCE antibody was raised using the middle region of FANCE corresponding to a region with amino acids SPQAPDPEEEENRDSQQPGKRRKDSEEEAASPEGKRVPKRLRCWEEEEDH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FANCE Blocking Peptide, catalog no. 33R-8689, is also available for use as a blocking control in assays to test for specificity of this FANCE antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FANCE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FANCE

Antigène: FANCE (Fanconi Anemia, Complementation Group E (FANCE))

Autre désignation: FANCE (FANCE Produits)

Synonymes: anticorps FANCE, anticorps fae, anticorps face, anticorps FACE, anticorps FAE, anticorps 2810451D06Rik, anticorps AI415634, anticorps AW209126, anticorps RGD1561045, anticorps Fanconi anemia complementation group E, anticorps Fanconi anemia, complementation group E, anticorps FANCE, anticorps fance, anticorps Fance

Sujet: The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair.

Poids moléculaire: 59 kDa (MW of target protein)

Pathways: Réparation de l'ADN