TNPO2 anticorps
-
- Antigène Voir toutes TNPO2 Anticorps
- TNPO2 (Transportin 2 (TNPO2))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TNPO2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- Transportin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MDWQPDEQGLQQVLQLLKDSQSPNTATQRIVQDKLKQLNQFPDFNNYLIF
- Top Product
- Discover our top product TNPO2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Transportin 2 Blocking Peptide, catalog no. 33R-5883, is also available for use as a blocking control in assays to test for specificity of this Transportin 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNPO2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TNPO2 (Transportin 2 (TNPO2))
- Autre désignation
- Transportin 2 (TNPO2 Produits)
- Synonymes
- anticorps TNPO2, anticorps IPO3, anticorps KPNB2B, anticorps TRN2, anticorps ik:tdsubc_2a7, anticorps tdsubc_2a7, anticorps wu:fb01c02, anticorps wu:fe01f03, anticorps wu:fe16e12, anticorps xx:tdsubc_2a7, anticorps zgc:101009, anticorps 1110034O24Rik, anticorps AA414969, anticorps AI464345, anticorps AI852433, anticorps Knpb2b, anticorps Kpnb2b, anticorps transportin 2, anticorps transportin 2 L homeolog, anticorps transportin 2 (importin 3, karyopherin beta 2b), anticorps TNPO2, anticorps tnpo2.L, anticorps Tnpo2, anticorps tnpo2
- Sujet
- Transportin-2 (TNPO2) mediates nuclear import of HuR protein in vitro. It also participates in mRNA export from the nucleus.
- Poids moléculaire
- 100 kDa (MW of target protein)
-