DYNLL2 anticorps (N-Term)

N° du produit ABIN630885

Détail du produit anti-DYNLL2 anticorps

Antigène: DYNLL2 (Dynein, Light Chain, LC8-Type 2 (DYNLL2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, C. elegans, Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DYNLL2 est non-conjugé

Application: Western Blotting (WB)

Specificité: DYNLL2 antibody was raised against the N terminal of DYNLL2

Purification: Affinity purified

Immunogène: DYNLL2 antibody was raised using the N terminal of DYNLL2 corresponding to a region with amino acids MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DYNLL2 Blocking Peptide, catalog no. 33R-6410, is also available for use as a blocking control in assays to test for specificity of this DYNLL2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYNLL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DYNLL2

Antigène: DYNLL2 (Dynein, Light Chain, LC8-Type 2 (DYNLL2))

Autre désignation: DYNLL2 (DYNLL2 Produits)

Synonymes: anticorps DNCL1B, anticorps Dlc2, anticorps RSPH22, anticorps dlc2, anticorps dncl1b, anticorps 1700064A15Rik, anticorps 6720463E02Rik, anticorps C87222, anticorps DLC8, anticorps DLC8b, anticorps dynein light chain LC8-type 2, anticorps dynein light chain LC8-type 2 S homeolog, anticorps DYNLL2, anticorps dynll2.S, anticorps dynll2, anticorps Dynll2

Sujet: DYNLL2 belongs to the dynein light chain family. DYNLL2 may be involved in some aspects of dynein-related intracellular transport and motility. It may play a role in changing or maintaining the spatial distribution of cytoskeletal structures.

Poids moléculaire: 10 kDa (MW of target protein)

Pathways: M Phase