GAMT anticorps (Middle Region)

N° du produit ABIN630904

Détail du produit anti-GAMT anticorps

Antigène: GAMT (Guanidinoacetate N-Methyltransferase (GAMT))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GAMT est non-conjugé

Application: Western Blotting (WB)

Specificité: GAMT antibody was raised against the middle region of GAMT

Purification: Affinity purified

Immunogène: GAMT antibody was raised using the middle region of GAMT corresponding to a region with amino acids PGEGPFLTPWVGWTVLVHLEIKVLCLAQWLPGAVAQVYNPSTVEGRGGQI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GAMT Blocking Peptide, catalog no. 33R-7098, is also available for use as a blocking control in assays to test for specificity of this GAMT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAMT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GAMT

Antigène: GAMT (Guanidinoacetate N-Methyltransferase (GAMT))

Autre désignation: GAMT (GAMT Produits)

Synonymes: anticorps gamt, anticorps zgc:123136, anticorps CCDS2, anticorps PIG2, anticorps TP53I2, anticorps AA571402, anticorps Spintz1, anticorps MGC75698, anticorps GAMT, anticorps GMT, anticorps guanidinoacetate N-methyltransferase L homeolog, anticorps guanidinoacetate N-methyltransferase S homeolog, anticorps guanidinoacetate N-methyltransferase, anticorps guanidinoacetate methyltransferase, anticorps gamt.L, anticorps gamt.S, anticorps gamt, anticorps GAMT, anticorps Gamt

Sujet: GAMT is a methyltransferase that converts guanidoacetate to creatine, using S-adenosylmethionine as the methyl donor. Defects in its gene have been implicated in neurologic syndromes and muscular hypotonia.

Poids moléculaire: 29 kDa (MW of target protein)