Arylsulfatase A anticorps (Middle Region)
-
- Antigène Voir toutes Arylsulfatase A (ARSA) Anticorps
- Arylsulfatase A (ARSA)
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Arylsulfatase A est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ARSA antibody was raised against the middle region of ARSA
- Purification
- Affinity purified
- Immunogène
- ARSA antibody was raised using the middle region of ARSA corresponding to a region with amino acids KQLQLLKAQLDAAVTFGPSQVARGEDPALQICCHPGCTPRPACCHCPDPH
- Top Product
- Discover our top product ARSA Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ARSA Blocking Peptide, catalog no. 33R-4608, is also available for use as a blocking control in assays to test for specificity of this ARSA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARSA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Arylsulfatase A (ARSA)
- Autre désignation
- ARSA (ARSA Produits)
- Synonymes
- anticorps ARSA, anticorps zgc:101575, anticorps arsa, anticorps AS-A, anticorps ASA, anticorps AW212749, anticorps As-2, anticorps As2, anticorps TISP73, anticorps MLD, anticorps mld, anticorps arylsulfatase A, anticorps arylsulfatase, anticorps arylsulfatase A, gene 1 S homeolog, anticorps ARSA, anticorps arsa, anticorps arsA, anticorps RB6599, anticorps Arsa, anticorps arsa.1.S
- Sujet
- ARSA hydrolyzes cerebroside sulfate. Defects in ARSA are a cause of leukodystrophy metachromatic (MLD).
- Poids moléculaire
- 52 kDa (MW of target protein)
-