HUS1B anticorps

N° du produit ABIN630912

Détail du produit anti-HUS1B anticorps

Antigène: HUS1B (HUS1 Checkpoint Homolog B (HUS1B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HUS1B est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: HUS1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids ELFIHVSGTVARLAKVCVLRVRPDSLCFGPAGSGGLHEARLWCEVRQGAF

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HUS1B Blocking Peptide, catalog no. 33R-2540, is also available for use as a blocking control in assays to test for specificity of this HUS1B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HUS0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HUS1B

Antigène: HUS1B (HUS1 Checkpoint Homolog B (HUS1B))

Autre désignation: HUS1B (HUS1B Produits)

Synonymes: anticorps HUS1B, anticorps RP11-532F6.1, anticorps HUS1 checkpoint clamp component B, anticorps HUS1B, anticorps Hus1b

Sujet: HUS1Bis most closely related to HUS1, a component of a cell cycle checkpoint protein complex involved in cell cycle arrest in response to DNA damage. HUS1B can interact with the check point protein RAD1 but not with RAD9. Overexpression of HUS1B has been shown to induce cell death, which suggests a related but distinct role of this protein, as compared to the HUS1.

Poids moléculaire: 31 kDa (MW of target protein)