PSMB1 anticorps
-
- Antigène Voir toutes PSMB1 Anticorps
- PSMB1 (Proteasome (Prosome, Macropain) Subunit, beta Type, 1 (PSMB1))
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PSMB1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PSMB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVG
- Top Product
- Discover our top product PSMB1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PSMB1 Blocking Peptide, catalog no. 33R-6806, is also available for use as a blocking control in assays to test for specificity of this PSMB1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMB1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PSMB1 (Proteasome (Prosome, Macropain) Subunit, beta Type, 1 (PSMB1))
- Autre désignation
- PSMB1 (PSMB1 Produits)
- Synonymes
- anticorps DDBDRAFT_0217063, anticorps DDBDRAFT_0232957, anticorps DDB_0217063, anticorps DDB_0232957, anticorps AA409053, anticorps C81484, anticorps Lmpc5, anticorps HC5, anticorps PMSB1, anticorps PSC5, anticorps wu:fc51f06, anticorps zgc:103665, anticorps proteasome subunit beta 1, anticorps 20S proteasome subunit beta-1, anticorps proteasome subunit beta type 1, anticorps proteasome (prosome, macropain) subunit, beta type 1, anticorps proteasome subunit beta 1 S homeolog, anticorps psmb1, anticorps PSMB1, anticorps psmB1, anticorps LOC100286342, anticorps Psmb1, anticorps psmb1.S
- Sujet
- The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMB1 is a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit.
- Poids moléculaire
- 26 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
-