PSMA3 anticorps
-
- Antigène Voir toutes PSMA3 Anticorps
- PSMA3 (Proteasome Subunit Alpha Type 3 (PSMA3))
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PSMA3 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PSMA3 antibody was raised using a synthetic peptide corresponding to a region with amino acids TCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREE
- Top Product
- Discover our top product PSMA3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PSMA3 Blocking Peptide, catalog no. 33R-8998, is also available for use as a blocking control in assays to test for specificity of this PSMA3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMA3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PSMA3 (Proteasome Subunit Alpha Type 3 (PSMA3))
- Autre désignation
- PSMA3 (PSMA3 Produits)
- Synonymes
- anticorps HC8, anticorps PSC3, anticorps Psma3l, anticorps psma3, anticorps im:6909944, anticorps zgc:114044, anticorps Lmpc8, anticorps proteasome subunit alpha 3, anticorps proteasome subunit alpha 3 L homeolog, anticorps proteasome (prosome, macropain) subunit, alpha type 3, anticorps PSMA3, anticorps Psma3, anticorps psma3.L, anticorps psma3
- Sujet
- The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA3 is a member of the peptidase T1A family, that is a 20S core alpha subunit.
- Poids moléculaire
- 28 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
-