STING/TMEM173 anticorps (Middle Region)

N° du produit ABIN630932

Détail du produit anti-STING/TMEM173 anticorps

Antigène: STING/TMEM173 (TMEM173) (Transmembrane Protein 173 (TMEM173))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp STING/TMEM173 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM173 antibody was raised against the middle region of TMEM173

Purification: Affinity purified

Immunogène: TMEM173 antibody was raised using the middle region of TMEM173 corresponding to a region with amino acids DPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM173 Blocking Peptide, catalog no. 33R-2109, is also available for use as a blocking control in assays to test for specificity of this TMEM173 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM173 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur STING/TMEM173

Antigène: STING/TMEM173 (TMEM173) (Transmembrane Protein 173 (TMEM173))

Autre désignation: TMEM173 (TMEM173 Produits)

Synonymes: anticorps ERIS, anticorps MITA, anticorps MPYS, anticorps NET23, anticorps STING, anticorps 2610307O08Rik, anticorps Mita, anticorps RGD1562552, anticorps transmembrane protein 173, anticorps TMEM173, anticorps Tmem173

Sujet: TMEM173 acts as a facilitator of innate immune signaling. It is able to activate both NF-kappa-B and IRF3 transcription pathways to induce expression of type I interferon (IFN-alpha and IFN-beta) and exert a potent anti-viral state following expression. TMEM173 may be involved in translocon function, the translocon possibly being able to influence the induction of type I interferons.It also may be involved in transduction of apoptotic signals via its association with the major histocompatibility complex class II (MHC-II). TMEM173 mediates death signaling via activation of the extracellular signal-regulated kinase (ERK) pathway.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Activation of Innate immune Response