KIR2DL4/CD158d anticorps (Middle Region)

N° du produit ABIN630938

Détail du produit anti-KIR2DL4/CD158d anticorps

Antigène: KIR2DL4/CD158d (KIR2DL4) (Killer Cell Immunoglobulin-Like Receptor, Two Domains, Long Cytoplasmic Tail, 4 (KIR2DL4))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KIR2DL4/CD158d est non-conjugé

Application: Western Blotting (WB)

Specificité: KIR2 DL4 antibody was raised against the middle region of KIR2 L4

Purification: Affinity purified

Immunogène: KIR2 DL4 antibody was raised using the middle region of KIR2 L4 corresponding to a region with amino acids VSVTGNPSSSWPSPTEPSFKTGIARHLHAVIRYSVAIILFTILPFFLLHR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIR2DL4 Blocking Peptide, catalog no. 33R-9831, is also available for use as a blocking control in assays to test for specificity of this KIR2DL4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIR0 L4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KIR2DL4/CD158d

Antigène: KIR2DL4/CD158d (KIR2DL4) (Killer Cell Immunoglobulin-Like Receptor, Two Domains, Long Cytoplasmic Tail, 4 (KIR2DL4))

Autre désignation: KIR2DL4 (KIR2DL4 Produits)

Synonymes: anticorps G9P, anticorps CD158D, anticorps KIR103, anticorps KIR103AS, anticorps KIR2DL4, anticorps killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 4, anticorps killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4, anticorps KIR2DL4

Sujet: Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells.

Poids moléculaire: 30 kDa (MW of target protein)