NAT15 anticorps
-
- Antigène Voir toutes NAT15 Anticorps
- NAT15 (N-Acetyltransferase 15 (NAT15))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NAT15 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- NAT15 antibody was raised using a synthetic peptide corresponding to a region with amino acids DYIQHLGSALASLSPCSIPHRVYRQAHSLLCSFLPWSGISSKSGIEYSRT
- Top Product
- Discover our top product NAT15 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NAT15 Blocking Peptide, catalog no. 33R-2239, is also available for use as a blocking control in assays to test for specificity of this NAT15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAT15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NAT15 (N-Acetyltransferase 15 (NAT15))
- Autre désignation
- NAT15 (NAT15 Produits)
- Synonymes
- anticorps nat15, anticorps im:7141641, anticorps naa60, anticorps zgc:163109, anticorps HAT4, anticorps NAT15, anticorps 1200013P24Rik, anticorps AI315146, anticorps Nat15, anticorps RGD1308915, anticorps N(alpha)-acetyltransferase 60, NatF catalytic subunit, anticorps N-acetyltransferase 15 (GCN5-related, putative), anticorps naa60, anticorps nat15, anticorps NAA60, anticorps Naa60
- Sujet
- NAT15 most likely functions as an N-acetyltransferase.
- Poids moléculaire
- 27 kDa (MW of target protein)
-