NAT15 anticorps

N° du produit ABIN630953

Détail du produit anti-NAT15 anticorps

Antigène: NAT15 (N-Acetyltransferase 15 (NAT15))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NAT15 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: NAT15 antibody was raised using a synthetic peptide corresponding to a region with amino acids DYIQHLGSALASLSPCSIPHRVYRQAHSLLCSFLPWSGISSKSGIEYSRT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NAT15 Blocking Peptide, catalog no. 33R-2239, is also available for use as a blocking control in assays to test for specificity of this NAT15 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAT15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NAT15

Antigène: NAT15 (N-Acetyltransferase 15 (NAT15))

Autre désignation: NAT15 (NAT15 Produits)

Synonymes: anticorps nat15, anticorps im:7141641, anticorps naa60, anticorps zgc:163109, anticorps HAT4, anticorps NAT15, anticorps 1200013P24Rik, anticorps AI315146, anticorps Nat15, anticorps RGD1308915, anticorps N(alpha)-acetyltransferase 60, NatF catalytic subunit, anticorps N-acetyltransferase 15 (GCN5-related, putative), anticorps naa60, anticorps nat15, anticorps NAA60, anticorps Naa60

Sujet: NAT15 most likely functions as an N-acetyltransferase.

Poids moléculaire: 27 kDa (MW of target protein)