NAT15 anticorps

N° du produit ABIN630953

L’anticorps anti-NAT15 Polyclonal Lapin est utilisé pour la détection de NAT15 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour NAT15 anticorps (ABIN630953)

Antigène: NAT15 (N-Acetyltransferase 15 (NAT15))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NAT15 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NAT15 anticorps

Purification: Affinity purified

Immunogène: NAT15 antibody was raised using a synthetic peptide corresponding to a region with amino acids DYIQHLGSALASLSPCSIPHRVYRQAHSLLCSFLPWSGISSKSGIEYSRT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NAT15 Blocking Peptide, (ABIN937625), is also available for use as a blocking control in assays to test for specificity of this NAT15 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAT15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NAT15

Antigène: NAT15 (N-Acetyltransferase 15 (NAT15))

Autre désignation: NAT15

Sujet: NAT15 most likely functions as an N-acetyltransferase.

Poids moléculaire: 27 kDa (MW of target protein)