CCNDBP1 anticorps (Middle Region)

N° du produit ABIN630965

Détail du produit anti-CCNDBP1 anticorps

Antigène: CCNDBP1 (Cyclin D-Type Binding-Protein 1 (CCNDBP1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCNDBP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: Cyclin D-Type Binding-Protein 1 antibody was raised against the middle region of CCNDBP1

Purification: Affinity purified

Immunogène: Cyclin D-Type Binding-Protein 1 antibody was raised using the middle region of CCNDBP1 corresponding to a region with amino acids KNVDFVKDAHEEMEQAVEECDPYSGLLNDTEENNSDNHNHEDDVLGFPSN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Cyclin D-Type Binding-Protein 1 Blocking Peptide, catalog no. 33R-4575, is also available for use as a blocking control in assays to test for specificity of this Cyclin D-Type Binding-Protein 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCNDBP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CCNDBP1

Antigène: CCNDBP1 (Cyclin D-Type Binding-Protein 1 (CCNDBP1))

Autre désignation: Cyclin D-Type Binding-Protein 1 (CCNDBP1 Produits)

Synonymes: anticorps CCNDBP1, anticorps dip1, anticorps gcip, anticorps DIP1, anticorps GCIP, anticorps HHM, anticorps AU022347, anticorps Maid, anticorps SECC-8, anticorps SSEC-8, anticorps cyclin D1 binding protein 1, anticorps cyclin D-type binding-protein 1, anticorps CCNDBP1, anticorps ccndbp1, anticorps Ccndbp1

Sujet: This gene was identified by the interaction of its gene product with Grap2, a leukocyte-specific adaptor protein important for immune cell signaling. The protein encoded by this gene was shown to interact with cyclin D.

Poids moléculaire: 40 kDa (MW of target protein)