CCNDBP1 anticorps (Middle Region)
-
- Antigène Voir toutes CCNDBP1 Anticorps
- CCNDBP1 (Cyclin D-Type Binding-Protein 1 (CCNDBP1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CCNDBP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Cyclin D-Type Binding-Protein 1 antibody was raised against the middle region of CCNDBP1
- Purification
- Affinity purified
- Immunogène
- Cyclin D-Type Binding-Protein 1 antibody was raised using the middle region of CCNDBP1 corresponding to a region with amino acids KNVDFVKDAHEEMEQAVEECDPYSGLLNDTEENNSDNHNHEDDVLGFPSN
- Top Product
- Discover our top product CCNDBP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Cyclin D-Type Binding-Protein 1 Blocking Peptide, catalog no. 33R-4575, is also available for use as a blocking control in assays to test for specificity of this Cyclin D-Type Binding-Protein 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCNDBP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CCNDBP1 (Cyclin D-Type Binding-Protein 1 (CCNDBP1))
- Autre désignation
- Cyclin D-Type Binding-Protein 1 (CCNDBP1 Produits)
- Synonymes
- anticorps CCNDBP1, anticorps dip1, anticorps gcip, anticorps DIP1, anticorps GCIP, anticorps HHM, anticorps AU022347, anticorps Maid, anticorps SECC-8, anticorps SSEC-8, anticorps cyclin D1 binding protein 1, anticorps cyclin D-type binding-protein 1, anticorps CCNDBP1, anticorps ccndbp1, anticorps Ccndbp1
- Sujet
- This gene was identified by the interaction of its gene product with Grap2, a leukocyte-specific adaptor protein important for immune cell signaling. The protein encoded by this gene was shown to interact with cyclin D.
- Poids moléculaire
- 40 kDa (MW of target protein)
-