PARD6B anticorps

N° du produit ABIN630967

Détail du produit anti-PARD6B anticorps

Antigène: PARD6B (Par-6 Partitioning Defective 6 Homolog beta (PARD6B))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PARD6B est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PARD6 B antibody was raised using a synthetic peptide corresponding to a region with amino acids MNRSHRHGAGSGCLGTMEVKSKFGAEFRRFSLERSKPGKFEEFYGLLQHV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PARD6B Blocking Peptide, catalog no. 33R-6265, is also available for use as a blocking control in assays to test for specificity of this PARD6B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARD0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PARD6B

Antigène: PARD6B (Par-6 Partitioning Defective 6 Homolog beta (PARD6B))

Autre désignation: PARD6B (PARD6B Produits)

Synonymes: anticorps PARD6B, anticorps AV025615, anticorps Par6b, anticorps PAR6B, anticorps par-6, anticorps par6, anticorps pard6beta, anticorps si:dkey-192i18.6, anticorps PAR-6, anticorps PAR-6B, anticorps par-6 family cell polarity regulator beta, anticorps par-6 family cell polarity regulator beta S homeolog, anticorps par-6 partitioning defective 6 homolog beta (C. elegans), anticorps PARD6B, anticorps Pard6b, anticorps pard6b.S, anticorps pard6b

Sujet: This gene is a member of the PAR6 family and encodes a protein with a PSD95/Discs-large/ZO1 (PDZ) domain, an OPR domain and a semi-Cdc42/Rac interactive binding (CRIB) domain. This cytoplasmic protein is involved in asymmetrical cell division and cell polarization processes as a member of a multi-protein complex.

Poids moléculaire: 41 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization