NUSAP1 anticorps (C-Term)

N° du produit ABIN630984

Détail du produit anti-NUSAP1 anticorps

Antigène: NUSAP1 (Nucleolar and Spindle Associated Protein 1 (NUSAP1))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NUSAP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: NUSAP1 antibody was raised against the C terminal of NUSAP1

Purification: Affinity purified

Immunogène: NUSAP1 antibody was raised using the C terminal of NUSAP1 corresponding to a region with amino acids LKASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NUSAP1 Blocking Peptide, catalog no. 33R-5074, is also available for use as a blocking control in assays to test for specificity of this NUSAP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUSAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NUSAP1

Antigène: NUSAP1 (Nucleolar and Spindle Associated Protein 1 (NUSAP1))

Autre désignation: NUSAP1 (NUSAP1 Produits)

Synonymes: anticorps ANKT, anticorps BM037, anticorps LNP, anticorps NUSAP, anticorps PRO0310p1, anticorps Q0310, anticorps SAPL, anticorps 2610201A12Rik, anticorps AI481307, anticorps AW547774, anticorps BB165529, anticorps NuSAP, anticorps YF-9, anticorps ankt, anticorps fb76a01, anticorps fi37a11, anticorps sb:cb490, anticorps wu:fb76a01, anticorps wu:fi37a11, anticorps lnp, anticorps nusap, anticorps nusap1, anticorps sapl, anticorps nucleolar and spindle associated protein 1, anticorps nucleolar and spindle associated protein 1 L homeolog, anticorps nucleolar and spindle associated protein 1 S homeolog, anticorps NUSAP1, anticorps Nusap1, anticorps nusap1, anticorps nusap1.L, anticorps nusap1.S

Sujet: NUSAP1 is a microtubule-associated protein with the capacity to bundle and stabilize microtubules. It may associate with chromosomes and promote the organization of mitotic spindle microtubules around them.

Poids moléculaire: 25 kDa (MW of target protein)