TBC1D1 anticorps

N° du produit ABIN630988

Détail du produit anti-TBC1D1 anticorps

Antigène: TBC1D1 (TBC1 (Tre-2/USP6, BUB2, Cdc16) Domain Family, Member 1 (TBC1D1))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TBC1D1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: TBC1 D1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RGSPGVSQRKLMRYHSVSTETPHERKDFESKANHLGDSGGTPVKTRRHSW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TBC1D1 Blocking Peptide, catalog no. 33R-7942, is also available for use as a blocking control in assays to test for specificity of this TBC1D1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TBC1D1

Antigène: TBC1D1 (TBC1 (Tre-2/USP6, BUB2, Cdc16) Domain Family, Member 1 (TBC1D1))

Autre désignation: TBC1D1 (TBC1D1 Produits)

Synonymes: anticorps TBC1D1, anticorps TBC, anticorps TBC1, anticorps 1110062G02Rik, anticorps AI385682, anticorps AW555803, anticorps Tbc1, anticorps mKIAA1108, anticorps TBC1 domain family member 1, anticorps TBC1 (tre-2/USP6, BUB2, cdc16) domain family, member 1, anticorps TBC1 domain family, member 1, anticorps TBC1D1, anticorps tbc1d1, anticorps LOC100523386, anticorps Tbc1d1

Sujet: TBC1D1 is the founding member of a family of proteins sharing a 180- to 200-amino acid TBC domain presumed to have a role in regulating cell growth and differentiation. These proteins share significant homology with TRE2 (USP6), yeast Bub2, and CDC16.

Poids moléculaire: 133 kDa (MW of target protein)