TCL1A anticorps (N-Term)

N° du produit ABIN631022

Détail du produit anti-TCL1A anticorps

Antigène: TCL1A (T-Cell Leukemia/lymphoma 1A (TCL1A))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TCL1A est non-conjugé

Application: Western Blotting (WB)

Specificité: TCL1 A antibody was raised against the N terminal of TCL1

Purification: Affinity purified

Immunogène: TCL1 A antibody was raised using the N terminal of TCL1 corresponding to a region with amino acids MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TCL1A Blocking Peptide, catalog no. 33R-5631, is also available for use as a blocking control in assays to test for specificity of this TCL1A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCL0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TCL1A

Antigène: TCL1A (T-Cell Leukemia/lymphoma 1A (TCL1A))

Autre désignation: TCL1A (TCL1A Produits)

Synonymes: anticorps TCL1A, anticorps Tcl1a, anticorps TCL1, anticorps Tcl1, anticorps T-cell leukemia/lymphoma 1A, anticorps T cell lymphoma breakpoint 1, anticorps TCL1A, anticorps Tcl1, anticorps Tcl1a

Sujet: TCL1A can enhance the phosphorylation and activation of AKT1, AKT2 and AKT3, promote nuclear translocation of AKT1, enhance cell proliferation, stabilize mitochondrial membrane potential and promote cell survival.

Poids moléculaire: 13 kDa (MW of target protein)

Pathways: Stem Cell Maintenance