PPM1K anticorps
-
- Antigène Voir toutes PPM1K Anticorps
- PPM1K (Protein Phosphatase, Mg2+/Mn2+ Dependent, 1K (PPM1K))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PPM1K est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PPM1 K antibody was raised using a synthetic peptide corresponding to a region with amino acids AHAVTEQAIQYGTEDNSTAVVVPFGAWGKYKNSEINFSFSRSFASSGRWA
- Top Product
- Discover our top product PPM1K Anticorps primaire
-
anti-Protein Phosphatase, Mg2+/Mn2+ Dependent, 1K (PPM1K) (AA 30-372) antibody
PPM1K Reactivité: Humain WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Protein Phosphatase, Mg2+/Mn2+ Dependent, 1K (PPM1K) antibodyPPM1K Reactivité: Humain, Souris ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Protein Phosphatase, Mg2+/Mn2+ Dependent, 1K (PPM1K) antibodyPPM1K Reactivité: Humain WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Protein Phosphatase, Mg2+/Mn2+ Dependent, 1K (PPM1K) (Internal Region) antibodyPPM1K Reactivité: Humain, Souris WB, ELISA, IHC, ICC, IF Hôte: Lapin Polyclonal unconjugated
anti-Protein Phosphatase, Mg2+/Mn2+ Dependent, 1K (PPM1K) (AA 1-372) antibodyPPM1K Reactivité: Humain WB Hôte: Souris Polyclonal unconjugated
anti-Protein Phosphatase, Mg2+/Mn2+ Dependent, 1K (PPM1K) (AA 183-372) antibodyPPM1K Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
anti-Protein Phosphatase, Mg2+/Mn2+ Dependent, 1K (PPM1K) (C-Term) antibodyPPM1K Reactivité: Humain, Souris, Rat, Cobaye, Cheval, Lapin, Poisson zèbre (Danio rerio), Singe, Xenopus laevis WB Hôte: Lapin Polyclonal unconjugated
anti-Protein Phosphatase, Mg2+/Mn2+ Dependent, 1K (PPM1K) antibodyPPM1K Reactivité: Humain, Souris, Boeuf (Vache) WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-Protein Phosphatase, Mg2+/Mn2+ Dependent, 1K (PPM1K) (AA 205-254) antibodyPPM1K Reactivité: Humain, Souris WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Protein Phosphatase, Mg2+/Mn2+ Dependent, 1K (PPM1K) (AA 1-324), (N-Term) antibodyPPM1K Reactivité: Humain, Souris, Boeuf (Vache) WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PPM1K Blocking Peptide, catalog no. 33R-1241, is also available for use as a blocking control in assays to test for specificity of this PPM1K antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPM0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PPM1K (Protein Phosphatase, Mg2+/Mn2+ Dependent, 1K (PPM1K))
- Autre désignation
- PPM1K (PPM1K Produits)
- Synonymes
- anticorps 2900063A19Rik, anticorps A930026L03Rik, anticorps PP2Cm, anticorps im:6912645, anticorps zgc:113207, anticorps BDP, anticorps MSUDMV, anticorps PP2Ckappa, anticorps PTMP, anticorps UG0882E07, anticorps RGD1308501, anticorps protein phosphatase 1K (PP2C domain containing), anticorps protein phosphatase, Mg2+/Mn2+ dependent, 1K, anticorps protein phosphatase, Mg2+/Mn2+ dependent 1K, anticorps protein phosphatase, Mg2+/Mn2+ dependent 1K S homeolog, anticorps Ppm1k, anticorps ppm1k, anticorps PPM1K, anticorps ppm1k.S
- Sujet
- PPM1K regulates the mitochondrial permeability transition pore and is essential for cellular survival and development.
- Poids moléculaire
- 41 kDa (MW of target protein)
-
