Medium-Chain Specific Acyl-CoA Dehydrogenase, Mitochondrial (N-Term) anticorps
-
- Antigène
- Medium-Chain Specific Acyl-CoA Dehydrogenase, Mitochondrial
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Inconjugué
-
Application
- Western Blotting (WB)
- Specificité
- ACADM antibody was raised against the N terminal of ACADM
- Purification
- Affinity purified
- Immunogène
- ACADM antibody was raised using the N terminal of ACADM corresponding to a region with amino acids AAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQAT
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ACADM Blocking Peptide, catalog no. 33R-1020, is also available for use as a blocking control in assays to test for specificity of this ACADM antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACADM antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Medium-Chain Specific Acyl-CoA Dehydrogenase, Mitochondrial
- Autre désignation
- ACADM
- Synonymes
- anticorps ACAD1, anticorps MCAD, anticorps MCADH, anticorps AU018656, anticorps acyl-CoA dehydrogenase medium chain, anticorps acyl-Coenzyme A dehydrogenase, medium chain, anticorps acyl-CoA dehydrogenase, C-4 to C-12 straight chain, anticorps ACADM, anticorps Acadm
- Sujet
- ACADM Is the medium-chain specific (C4 to C12 straight chain) acyl-Coenzyme A dehydrogenase. The homotetramer enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Clinical phenotypes are associated with ACADM hereditary deficiency.
- Poids moléculaire
- 46 kDa (MW of target protein)
-