Medium-Chain Specific Acyl-CoA Dehydrogenase, Mitochondrial (N-Term) anticorps

N° du produit ABIN631056

Détail du produit

Antigène: Medium-Chain Specific Acyl-CoA Dehydrogenase, Mitochondrial

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Specificité: ACADM antibody was raised against the N terminal of ACADM

Purification: Affinity purified

Immunogène: ACADM antibody was raised using the N terminal of ACADM corresponding to a region with amino acids AAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQAT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACADM Blocking Peptide, catalog no. 33R-1020, is also available for use as a blocking control in assays to test for specificity of this ACADM antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACADM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Medium-Chain Specific Acyl-CoA Dehydrogenase, Mitochondrial

Autre désignation: ACADM

Synonymes: anticorps ACAD1, anticorps MCAD, anticorps MCADH, anticorps AU018656, anticorps acyl-CoA dehydrogenase medium chain, anticorps acyl-Coenzyme A dehydrogenase, medium chain, anticorps acyl-CoA dehydrogenase, C-4 to C-12 straight chain, anticorps ACADM, anticorps Acadm

Sujet: ACADM Is the medium-chain specific (C4 to C12 straight chain) acyl-Coenzyme A dehydrogenase. The homotetramer enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Clinical phenotypes are associated with ACADM hereditary deficiency.

Poids moléculaire: 46 kDa (MW of target protein)