FBXO31 anticorps (Middle Region)

N° du produit ABIN631073

Détail du produit anti-FBXO31 anticorps

Antigène: FBXO31 (F-Box Protein 31 (FBXO31))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FBXO31 est non-conjugé

Application: Western Blotting (WB)

Specificité: FBXO31 antibody was raised against the middle region of FBXO31

Purification: Affinity purified

Immunogène: FBXO31 antibody was raised using the middle region of FBXO31 corresponding to a region with amino acids VAAAEQPAQCGQGQPFVLPVGVSSRNEDYPRTCRMCFYGTGLIAGHGFTS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FBXO31 Blocking Peptide, catalog no. 33R-9406, is also available for use as a blocking control in assays to test for specificity of this FBXO31 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO31 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FBXO31

Antigène: FBXO31 (F-Box Protein 31 (FBXO31))

Autre désignation: FBXO31 (FBXO31 Produits)

Synonymes: anticorps 1110003O08Rik, anticorps 2310046N15Rik, anticorps Fbx14, anticorps Fbxo14, anticorps FBX14, anticorps FBXO14, anticorps Fbx31, anticorps pp2386, anticorps RGD1561069, anticorps fbx14, anticorps fbx31, anticorps fbxo14, anticorps fbxo31, anticorps F-box protein 31, anticorps F-box protein 31 S homeolog, anticorps F-box protein 31 L homeolog, anticorps Fbxo31, anticorps FBXO31, anticorps fbxo31, anticorps fbxo31.S, anticorps fbxo31.L

Sujet: FBXO31 is the component of some SCF (SKP1-cullin-F-box) protein ligase complex that plays a central role in G1 arrest following DNA damage. FBXO31 specifically recognises phosphorylated cyclin-D1 (CCND1), promoting its ubiquitination and degradation by the proteasome, resulting in G1 arrest.

Poids moléculaire: 40 kDa (MW of target protein)